NF2

NF2 (англ. Neurofibromin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 595 амінокислот, а молекулярна маса — 69 690[4].

Послідовність амінокислот
1020304050
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLV
CRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKF
YPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKY
GDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRAR
DEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRL
TPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAE
RTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQ
KAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKE
ADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNL
IGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALK
LKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
NF2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NF2, ACN, BANF, SCH, neurofibromin 2 (merlin), neurofibromin 2, merlin-1, moesin-ezrin-radixin like (MERLIN) tumor suppressor
Зовнішні ІД OMIM: 607379 MGI: 97307 HomoloGene: 2180 GeneCards: NF2
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
4771
18016
Ensembl
ENSG00000186575
ENSMUSG00000009073
UniProt
P35240
P46662
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 22: 29.6 – 29.7 Mb Хр. 11: 4.72 – 4.8 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних відростках.

Взаємодії

Доведено, що NF2 взаємодіє з:

Література

  • Schmucker B., Tang Y., Kressel M. (1999). Novel alternatively spliced isoforms of the neurofibromatosis type 2 tumor suppressor are targeted to the nucleus and cytoplasmic granules.. Hum. Mol. Genet. 8: 1561 — 1570. PubMed DOI:10.1093/hmg/8.8.1561
  • Chang L.-S., Akhmametyeva E.M., Wu Y., Zhu L., Welling D.B. (2002). Multiple transcription initiation sites, alternative splicing, and differential polyadenylation contribute to the complexity of human neurofibromatosis 2 transcripts.. Genomics 79: 63 — 76. PubMed DOI:10.1006/geno.2001.6672
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004. PubMed DOI:10.1101/gr.2596504
  • Rong R., Tang X., Gutmann D.H., Ye K. (2004). Neurofibromatosis 2 (NF2) tumor suppressor merlin inhibits phosphatidylinositol 3-kinase through binding to PIKE-L.. Proc. Natl. Acad. Sci. U.S.A. 101: 18200 — 18205. PubMed DOI:10.1073/pnas.0405971102
  • Huang J., Chen J. (2008). VprBP targets Merlin to the Roc1-Cul4A-DDB1 E3 ligase complex for degradation.. Oncogene 27: 4056 — 4064. PubMed DOI:10.1038/onc.2008.44
  • Genevet A., Wehr M.C., Brain R., Thompson B.J., Tapon N. (2010). Kibra Is a regulator of the Salvador/Warts/Hippo signaling network.. Dev. Cell 18: 300 — 308. PubMed DOI:10.1016/j.devcel.2009.12.011

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:7773 (англ.). Процитовано 12 вересня 2017.
  4. UniProt, P35240 (англ.). Процитовано 12 вересня 2017.
  5. Huang J, Chen J (July 2008). VprBP targets Merlin to the Roc1-Cul4A-DDB1 E3 ligase complex for degradation. Oncogene 27 (29): 4056–64. PMID 18332868. doi:10.1038/onc.2008.44.
  6. Grönholm M, Sainio M, Zhao F, Heiska L, Vaheri A, Carpén O (March 1999). Homotypic and heterotypic interaction of the neurofibromatosis 2 tumor suppressor protein merlin and the ERM protein ezrin. J. Cell Sci. 112 (6): 895–904. PMID 10036239.
  7. Gutmann DH, Haipek CA, Burke SP, Sun CX, Scoles DR, Pulst SM (April 2001). The NF2 interactor, hepatocyte growth factor-regulated tyrosine kinase substrate (HRS), associates with merlin in the "open" conformation and suppresses cell growth and motility. Hum. Mol. Genet. 10 (8): 825–34. PMID 11285248. doi:10.1093/hmg/10.8.825.
  8. Scoles DR, Huynh DP, Chen MS, Burke SP, Gutmann DH, Pulst SM (July 2000). The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor-regulated tyrosine kinase substrate. Hum. Mol. Genet. 9 (11): 1567–74. PMID 10861283. doi:10.1093/hmg/9.11.1567.
  9. Wiederhold T, Lee MF, James M, Neujahr R, Smith N, Murthy A, Hartwig J, Gusella JF, Ramesh V (November 2004). Magicin, a novel cytoskeletal protein associates with the NF2 tumor suppressor merlin and Grb2. Oncogene 23 (54): 8815–25. PMID 15467741. doi:10.1038/sj.onc.1208110.
  10. Jannatipour M, Dion P, Khan S, Jindal H, Fan X, Laganière J, Chishti AH, Rouleau GA (August 2001). Schwannomin isoform-1 interacts with syntenin via PDZ domains. J. Biol. Chem. 276 (35): 33093–100. PMID 11432873. doi:10.1074/jbc.M105792200.
  11. Neill GW, Crompton MR (September 2001). Binding of the merlin-I product of the neurofibromatosis type 2 tumour suppressor gene to a novel site in beta-fodrin is regulated by association between merlin domains. Biochem. J. 358 (Pt 3): 727–35. PMC 1222106. PMID 11535133. doi:10.1042/0264-6021:3580727.

Див. також

This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.